Analytical Data
-
Gene name
C1orf57
- Application
-
Alternative Names
NTPCR; C1orf57; Cancer-related nucleoside-triphosphatase; NTPase; EC 3.6.1.15; Nucleoside triphosphate phosphohydrolase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BSD7
-
Expression Region
1-190aa
-
AA Sequence
MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
-
Molecular Weight
47.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf57, also known as Chromosome 1 Open Reading Frame 57, is a gene located on chromosome 1 that has garnered interest in recent years due to its potential implications in various biological processes and diseases. Research indicates that C1orf57 may play a role in cellular mechanisms such as cell proliferation, apoptosis, and immune responses. However, its exact functions and the pathways in which it is involved are still not fully understood. The study of C1orf57 recombinant proteins provides a valuable tool for elucidating the gene's biological role, facilitating the investigation of its interactions with other cellular proteins, and uncovering its potential influence on metabolic and signaling pathways. Additionally, understanding the structure and function of C1orf57 could lead to novel insights into its involvement in pathologies, including cancer and autoimmune disorders. As researchers produce recombinant forms of the C1orf57 protein, they aim to analyze its properties, including stability, activity, and interaction with other biomolecules, thereby laying the groundwork for potential therapeutic applications. Overall, the exploration of C1orf57 recombinant proteins represents a promising avenue for advancing our knowledge of this gene and its biological significance.
