Cat: PA2000-6132

Recombinant Human C1orf57 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C1orf57

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NTPCR; C1orf57; Cancer-related nucleoside-triphosphatase; NTPase; EC 3.6.1.15; Nucleoside triphosphate phosphohydrolase

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BSD7

  • Expression Region

    1-190aa

  • AA Sequence

    MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK

  • Molecular Weight

    47.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C1orf57, also known as Chromosome 1 Open Reading Frame 57, is a gene located on chromosome 1 that has garnered interest in recent years due to its potential implications in various biological processes and diseases. Research indicates that C1orf57 may play a role in cellular mechanisms such as cell proliferation, apoptosis, and immune responses. However, its exact functions and the pathways in which it is involved are still not fully understood. The study of C1orf57 recombinant proteins provides a valuable tool for elucidating the gene's biological role, facilitating the investigation of its interactions with other cellular proteins, and uncovering its potential influence on metabolic and signaling pathways. Additionally, understanding the structure and function of C1orf57 could lead to novel insights into its involvement in pathologies, including cancer and autoimmune disorders. As researchers produce recombinant forms of the C1orf57 protein, they aim to analyze its properties, including stability, activity, and interaction with other biomolecules, thereby laying the groundwork for potential therapeutic applications. Overall, the exploration of C1orf57 recombinant proteins represents a promising avenue for advancing our knowledge of this gene and its biological significance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US