Analytical Data
-
Gene name
MIG7
- Application
-
Alternative Names
MIG7；MADS-box MEF2 type transcription factor MIG1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q1AHR6
-
Expression Region
1-207aa
-
AA Sequence
MAASRCSGLSEMTLLGSQAVSGLSSPLKSPCQVWNSPSPVCVCVCVCVCVCTRVHMRACSAGSAYLKQMKFCRMAASLDKVKKTDRGERGSCVSTTKRQASLSQRDIPSNNMKLATFPSDVNVESVAASLFFTVMKLGATQLEWNTKTPLGNTSSGFESQLYHSPAIDSEQDLSEVISSQSVETRLTSKVLKVEPESMNAKVFTFKL
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MIG7, or Migration Induced Gene 7, is a protein that has garnered significant attention in recent years due to its potential role in cellular migration and related processes. Originally identified in vertebrate models, MIG7 is believed to be involved in various biological functions, including cell adhesion, migration, and possibly tumor progression. The significance of MIG7 in cancer biology stems from its upregulation in certain malignancies, suggesting that it may contribute to the invasive characteristics of cancer cells. Research has shown that MIG7 interacts with key signaling pathways and cytoskeletal components, thereby influencing cellular motility and behavior. Additionally, studies indicate its potential as a biomarker for certain cancers, offering avenues for early diagnosis or targeted therapy. Understanding the mechanistic pathways of MIG7 may provide insights into its role in not only cancer but also in wound healing and development, making it a valuable target for further investigation in both basic and translational research fields. As such, ongoing studies aim to elucidate the functional roles of MIG7, its regulatory mechanisms, and its interactions within the cellular microenvironment, ultimately contributing to the development of innovative therapeutic strategies.
