Analytical Data
-
Gene name
C20orf112
- Application
-
Alternative Names
C20orf112; C20orf113; Chromosome 20 open reading frame 112; CT112_HUMAN; dJ1184F4.2; dJ1184F4.4; DKFZp566G1424; Hypothetical Protein LOC140688; Uncharacterized Protein C20orf112
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MY1
-
Expression Region
1-398aa
-
AA Sequence
MSDSTWMSADPHLASSLSPSQDERMRSPQNLHSQEDDDSSSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDEPIALDKQHSRDSAAITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNLQPPASLQTGNHSNGPTDLSMKGGASTTSTTPSALSGEPPTRRWGCSSV
-
Molecular Weight
69.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf112, a gene located on chromosome 20, has garnered attention due to its potential roles in cellular processes and human diseases. This gene encodes a protein that is believed to be involved in various biological functions, including cell signaling, apoptosis, and immune responses. Recent studies have suggested that C20orf112 may play a significant role in cancer progression and development, making it a target of interest for therapeutic interventions. The recombinant expression of C20orf112 protein allows researchers to elucidate its structure, function, and interactions with other cellular components. Understanding the molecular mechanisms mediated by C20orf112 could provide insights into its involvement in disease states and contribute to the identification of novel biomarkers or therapeutic targets. Additionally, the development of specific antibodies against the C20orf112 protein could facilitate the exploration of its expression patterns in different tissues and conditions, further highlighting its clinical relevance. Overall, the study of C20orf112 recombinant protein represents a promising avenue for advancing our understanding of its biological significance and potential implications in health and disease.
