Analytical Data
-
Gene name
C20orf27
- Application
-
Alternative Names
C20orf27UPF0687 Protein C20orf27
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZN8
-
Expression Region
1-174aa
-
AA Sequence
MAAANKGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKILHRYEITFTLPPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEILLACEGGTGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD
-
Molecular Weight
44.88 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf27, a gene located on chromosome 20, has garnered increasing attention in the field of molecular biology due to its potential implications in various biological processes and disease mechanisms. Preliminary studies suggest that C20orf27 may play a role in cell signaling pathways, developmental processes, and possibly in the regulation of immune responses. However, its exact function remains largely undefined, partly due to the lack of comprehensive research on the protein it encodes. The protein's structure and functional domains are yet to be elucidated, which hampers our understanding of its biological significance. Recombinant protein studies have emerged as a crucial approach to explore C20orf27, facilitating the production of the protein in a controlled environment for functional assays. Research involving the overexpression of C20orf27 in model systems could provide insights into its biological activity, interactions with other cellular components, and any potential roles in pathological conditions such as cancer or autoimmune diseases. The generation of specific antibodies against C20orf27 will further aid in the identification and localization of this protein in various tissues. Overall, intensified research on C20orf27 recombinant protein is essential for clarifying its biological roles and assessing its potential as a therapeutic target or biomarker in human health and disease.
