Analytical Data
-
Gene name
C20orf35
- Application
-
Alternative Names
Dysbindin domain-containing Protein 2. Casein kinase-1 binding Protein. CK1BP. HSMNP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQY9
-
Expression Region
1-156aa
-
AA Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
-
Molecular Weight
44 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf35, also known as ROR1, is a gene located on chromosome 20 that has garnered attention due to its unique expression pattern and potential implications in various diseases, particularly in cancer. Initially identified in embryonic development, C20orf35 is typically downregulated in adult tissues, suggesting a role in normal physiological processes. However, its aberrant expression has been observed in several malignancies, including chronic lymphocytic leukemia and breast cancer, indicating its potential role as a tumor-associated antigen. Research into the recombinant protein of C20orf35 focuses on understanding its structural and functional properties, which may elucidate its involvement in tumorigenesis. The recombinant C20orf35 protein can serve as a valuable tool for developing targeted therapies and vaccines, as it may facilitate the design of immunological strategies that exploit the immune system’s ability to recognize and attack cancer cells expressing this protein. Furthermore, studying its interactions with other cellular pathways can provide insights into the mechanisms that drive cancer progression. Overall, the investigation of C20orf35 recombinant protein represents a promising frontier in cancer research, aiming to uncover novel therapeutic approaches and improve outcomes for patients.
