Analytical Data
-
Gene name
C21orf45
- Application
-
Alternative Names
MIS18A; C21orf45; C21orf46; FASP1; Protein Mis18-alpha; FAPP1-associated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYP9
-
Expression Region
1-233aa
-
AA Sequence
MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS
-
Molecular Weight
52.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C21orf45, also known as "chromosome 21 open reading frame 45," is a gene located on chromosome 21 that encodes a protein with unknown function, yet it has garnered interest due to its potential implications in various diseases, including cancer and genetic disorders. The study of C21orf45 recombinant protein is crucial for understanding its biological role, particularly in the context of Down syndrome, where abnormalities on chromosome 21 can lead to a range of phenotypic effects. Recent advances in recombinant DNA technology allow for the production of this protein in heterologous systems, enabling researchers to undertake functional assays and elucidate its interactions with other cellular components. Moreover, examining the structure and function of the C21orf45 protein can shed light on its potential involvement in cellular signaling pathways or metabolic processes. As a relatively under-explored protein, the study of C21orf45 may pave the way for novel therapeutic strategies targeting its function, offering insights into both its basic biology and its role in disease. Consequently, the research on C21orf45 recombinant protein serves as an important avenue for advancing our knowledge of gene functions, with significant implications for human health.
