Cat: PA2000-6201

Recombinant Human C21orf59 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C21orf59

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C21orf48; C21orf59; Chromosome 21 open reading frame 59; CILD26; CU059_HUMAN; FBB18; FLJ20467; FLJ37137; FLJ40247; Prostate cancer upregulated Protein 1; Uncharacterized Protein C21orf59

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P57076

  • Expression Region

    1-290aa

  • AA Sequence

    MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR

  • Molecular Weight

    59.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C21orf59, also known as "Chromosome 21 Open Reading Frame 59," has emerged as a significant protein in various biological studies, particularly in relation to cell growth and differentiation. Located on chromosome 21, it draws interest due to its potential implications in genetic disorders, including Down syndrome, where the overexpression of genes on this chromosome may contribute to the phenotypic traits observed in affected individuals. Recent research has focused on the recombinant expression of C21orf59 to better understand its functional role and interactions within cellular mechanisms. The availability of high-purity recombinant C21orf59 protein allows for in-depth analysis through biophysical and biochemical assays. These studies aim to elucidate its structure-function relationship, revealing how C21orf59 may participate in cellular pathways and influencing various diseases. Furthermore, understanding C21orf59’s role can provide insights into novel therapeutic targets for related genetic conditions. With advancements in recombinant DNA technology and protein purification methods, the investigation into C21orf59 is paving the way for significant breakthroughs in both basic research and potential clinical applications, highlighting the importance of this protein in the realm of molecular biology and genetics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US