Analytical Data
-
Gene name
wac
- Application
-
Alternative Names
wac；KIAA1844；WW domain-containing adapter Protein with coiled-coil
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10104
-
Expression Region
2-487aa
-
AA Sequence
TDIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDIEALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESDVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIGSDDIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSGGQPSPPGSLLNRVSTIETSVSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVFLSTFLSPA
-
Molecular Weight
67.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WAC (WW domain-containing adaptor with coiled-coil) is a protein that plays a significant role in various cellular processes, including signal transduction, cell division, and transcriptional regulation. Research into WAC has gained traction as it has been implicated in several diseases, including cancer and neurodegenerative disorders. The protein contains multiple functional domains, such as WW and coiled-coil motifs, which facilitate its interactions with other proteins and contribute to its multifunctional nature. Understanding WAC's structure and function is vital for elucidating its role in normal cellular physiology as well as in pathologies. Recent studies leveraging advanced techniques like X-ray crystallography and cryo-electron microscopy aim to reveal the intricate molecular mechanisms by which WAC influences cellular behavior. Furthermore, investigations into WAC’s dysregulation in disease contexts highlight its potential as a therapeutic target, making it a focal point for drug discovery efforts. Overall, the study of WAC provides crucial insights into the complex regulatory networks governing cellular functions, illustrating the importance of this protein in both health and disease.
