Analytical Data
-
Gene name
EBNA3
- Application
-
Alternative Names
EBNA3；UBH1；USP12L1；Ubiquitin carboxyl-terminal hydrolase 12
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3KST2
-
Expression Region
1-138aa
-
AA Sequence
MDKDRPGDPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAQLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA
-
Molecular Weight
22.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EBNA3 proteins, encoded by the Epstein-Barr virus (EBV), play a crucial role in the virus's ability to establish and maintain latency in host B cells. EBV is a member of the herpesvirus family and is associated with various human diseases, including infectious mononucleosis and certain malignancies such as Hodgkin lymphoma and nasopharyngeal carcinoma. The EBNA3 family consists of three members: EBNA3A, EBNA3B, and EBNA3C, each of which interacts with host cell proteins to modulate cellular processes, including proliferation and apoptosis. Research on recombinant EBNA3 proteins is pivotal for understanding their functions in viral pathogenesis and the immune response to EBV. Studies have shown that these proteins can interfere with the host's transcriptional machinery and affect the expression of key genes involved in immune regulation. By generating recombinant EBNA3 proteins, scientists aim to elucidate their molecular mechanisms, explore their potential as targets for therapeutic intervention, and develop vaccines to combat EBV-associated diseases. Additionally, this research provides insights into the complex interplay between viral proteins and host immune responses, which could lead to novel approaches for treating EBV-related diseases. Overall, the study of EBNA3 recombinant proteins is essential for advancing our understanding of EBV biology and its implications for human health.
