Analytical Data
-
Gene name
GLU-1D-1D
- Application
-
Alternative Names
GLU-1D-1D；GLUR5；Glutamate receptor ionotropic. kainate 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10388
-
Expression Region
22-194aa
-
AA Sequence
EGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPTSPQQPGQWQQPEQGQPRYYPTSPQQSGQLQQPAQGQQPGQGQQG
-
Molecular Weight
20.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLU-1D-1D recombinant protein has emerged as a focal point in the study of carbohydrate metabolism and its associated disorders. As one of the key members of the glutamate transporter family, GLU-1D-1D plays a vital role in the regulation of glutamate levels in the synaptic cleft, thereby influencing neurotransmission and neuronal excitability. Recent research has highlighted its importance in neurodegenerative diseases, such as Alzheimer's and Parkinson's, where impaired glutamate clearance may contribute to excitotoxicity and neuronal death. The characterization of GLU-1D-1D recombinant protein enables scientists to delve deeper into its structure-function relationships and its potential interactions with various ligands and inhibitors. Furthermore, recombinant production allows for the generation of large quantities of purified protein for biochemical assays and structural analysis, thereby facilitating the development of therapeutic strategies aimed at restoring normal glutamate homeostasis. As we continue to unravel the complexities of GLU-1D-1D’s function, its study not only enhances our understanding of neurobiology but also paves the way for innovative approaches in treating related pathologies. Overall, the research surrounding GLU-1D-1D recombinant protein underscores its significance in both basic and applied sciences, reflecting the growing recognition of the critical role of glutamate transporters in brain health.
