Cat: PA2000-2450

Recombinant E.coli GLU-1D-1D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLU-1D-1D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLU-1D-1D;GLUR5;Glutamate receptor ionotropic. kainate 1

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10388

  • Expression Region

    22-194aa

  • AA Sequence

    EGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPTSPQQPGQWQQPEQGQPRYYPTSPQQSGQLQQPAQGQQPGQGQQG

  • Molecular Weight

    20.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLU-1D-1D recombinant protein has emerged as a focal point in the study of carbohydrate metabolism and its associated disorders. As one of the key members of the glutamate transporter family, GLU-1D-1D plays a vital role in the regulation of glutamate levels in the synaptic cleft, thereby influencing neurotransmission and neuronal excitability. Recent research has highlighted its importance in neurodegenerative diseases, such as Alzheimer's and Parkinson's, where impaired glutamate clearance may contribute to excitotoxicity and neuronal death. The characterization of GLU-1D-1D recombinant protein enables scientists to delve deeper into its structure-function relationships and its potential interactions with various ligands and inhibitors. Furthermore, recombinant production allows for the generation of large quantities of purified protein for biochemical assays and structural analysis, thereby facilitating the development of therapeutic strategies aimed at restoring normal glutamate homeostasis. As we continue to unravel the complexities of GLU-1D-1D’s function, its study not only enhances our understanding of neurobiology but also paves the way for innovative approaches in treating related pathologies. Overall, the research surrounding GLU-1D-1D recombinant protein underscores its significance in both basic and applied sciences, reflecting the growing recognition of the critical role of glutamate transporters in brain health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US