Analytical Data
-
Gene name
C2orf65
- Application
-
Alternative Names
M1AP; C2orf65; SPATA37Meiosis 1 arrest Protein; Meiosis 1-arresting Protein; Meiosis 1-associated Protein; Spermatogenesis-associated Protein 37
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TC57
-
Expression Region
1-365aa
-
AA Sequence
MHPGRTTGKGPSTHTQIDQQPPRLLIVHIALPSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSRHVTTRAALTYTSLEITILTSQPGKEVVKQLEEGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDLQTIDNDIVSMEIFFKAWLHNSGTDQEQIHLLLSSQCFSNISRPRDNPMCLKCDLQERLLCPSLLAGTADGSLRMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHFHALCHSLLVSTHVPR
-
Molecular Weight
67.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf65, also known as "chromosome 2 open reading frame 65," is a gene that encodes a protein implicated in several cellular processes, including cellular metabolism and the development of certain diseases. Research surrounding C2orf65 has gained attention due to its potential role in inherited disorders, particularly those affecting vision and neurological functions. Mutations in this gene have been associated with retinitis pigmentosa, a degenerative eye disease that leads to vision loss, as well as other neurodegenerative conditions. Understanding the function and mechanisms of C2orf65 is crucial for elucidating its involvement in these diseases. Recent studies have focused on the characterization of C2orf65 recombinant proteins to explore their structure, interactions, and biological activities. By producing and studying these recombinant proteins, researchers aim to uncover the molecular pathways influenced by C2orf65 and identify potential therapeutic targets. Additionally, the investigation of C2orf65's role in cellular stress responses and its interaction with other proteins in signaling pathways provides valuable insights into its pathophysiological significance. Overall, ongoing research on C2orf65 and its recombinant protein is essential for advancing our knowledge of genetic disorders and developing innovative strategies for diagnosis and treatment.
