Analytical Data
-
Gene name
C6orf108
- Application
-
Alternative Names
2' deoxynucleoside 5' phosphate N hydrolase 1; BC048355; c Myc responsive; c Myc responsive Protein Rcl; c-Myc-responsive Protein Rcl; C6orf108; C76683; Chromosome 6 open reading frame 108; Deoxyribonucleoside 5' monophosphate N glycosidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43598
-
Expression Region
1-174aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAAAMVPGRSESWERGEPGRPALYFCGSIR GGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQD LEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAM IRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf108, also known as Chromosome 6 Open Reading Frame 108, is a gene of interest due to its potential role in various biological processes and disease pathways. Despite its initial identification, the functional characterization of C6orf108 has remained limited. Recent studies have suggested that this protein may be involved in cellular mechanisms such as cell proliferation and differentiation, potentially influencing cancer progression and other pathologies. The increasing availability of genomic data has prompted researchers to explore the expression patterns and interactions of C6orf108 in different tissues and under various physiological conditions. Understanding the biological role of C6orf108 and its protein product can provide insights into its contributions to normal cellular function and its implications in disease, particularly in terms of tumorigenesis and metabolic disorders. Moreover, the reconstitution of C6orf108 as a recombinant protein is vital for in vitro studies, enabling the assessment of its structural and functional properties, thus opening avenues for therapeutic interventions. By elucidating the biochemical pathways associated with C6orf108, researchers aim to delineate its potential as a biomarker or therapeutic target, contributing to the broader understanding of gene-environment interactions and their effects on human health. This research area is rapidly evolving, highlighting the need for comprehensive studies to unravel the complexities surrounding C6orf108 and its significance in modern biomedicine.
