Analytical Data
-
Gene name
UbcD6
- Application
-
Alternative Names
UbcD6；Dhr6；UbcD6；Ubiquitin-conjugating enzyme E2-17 kDa
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25153
-
Expression Region
1-151aa
-
AA Sequence
MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
-
Molecular Weight
19.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UbcD6, a member of the ubiquitin-conjugating enzyme family, plays a crucial role in the ubiquitin-proteasome system, which is responsible for protein degradation and regulation of various cellular processes. The study of UbcD6 has garnered significant interest due to its involvement in maintaining cellular protein homeostasis and its potential implications in various diseases, including cancer and neurodegenerative disorders. Research indicates that UbcD6 is essential for mediating protein ubiquitination, a post-translational modification that tags proteins for degradation, thereby influencing cell cycle regulation and stress responses. Furthermore, its unique properties, such as substrate specificity and interaction with other ubiquitin ligases, make it a valuable target for investigating the complexities of the ubiquitin signaling pathway. Understanding the structural and functional aspects of UbcD6, including its mechanism of action and regulatory features, could provide insights into the development of therapeutic strategies aimed at modulating this pathway in disease contexts. Recent advances in recombinant protein technology have facilitated the production and purification of UbcD6, enabling detailed biochemical and biophysical studies that aim to elucidate its role and interactions within the ubiquitin system. This research not only enhances our comprehension of UbcD6’s functional significance but also opens avenues for exploring its potential as a biomarker or therapeutic target in related medical conditions.
