Analytical Data
-
Gene name
Mug1
- Application
-
Alternative Names
Mug1；Mug-1；Murinoglobulin-1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28665
-
Expression Region
700-910aa
-
AA Sequence
TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE
-
Molecular Weight
27.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Mug1 is a novel recombinant protein that has garnered attention in the field of molecular biology due to its potential applications in various therapeutic and diagnostic contexts. The study of Mug1 is rooted in its origin from specific microbial systems, where it exhibits unique structural and functional characteristics. Researchers are particularly interested in its role in cellular processes and interactions, which may lead to new insights into cellular mechanisms and pathways. The protein is being explored for its utility in biotechnological applications, such as enzymatic assays, vaccine development, and targeted delivery systems. Understanding the molecular dynamics of Mug1, including its folding, stability, and interaction with other biomolecules, could unveil opportunities for innovation in medicine and biotechnology. As the demand for effective and efficient biopharmaceuticals rises, the recombinant expression and characterization of Mug1 promise to contribute significantly to advancements in therapeutics aimed at treating various diseases. The ongoing research endeavors seek to elucidate its biochemical properties, paving the way for future explorations into its practical applications in healthcare and beyond.
