Analytical Data
-
Gene name
HLA-A
- Application
-
Alternative Names
HLA-A；HLAA；HLA class I histocompatibility antigen. A alpha chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30443
-
Expression Region
25-308aa
-
AA Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI
-
Molecular Weight
38.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-A recombinant proteins have emerged as a focal point in immunological research due to their crucial role in the human immune response. Human leukocyte antigen (HLA) class I molecules, including HLA-A, are integral for presenting peptide fragments to CD8+ T cells, facilitating the detection and elimination of infected or malignant cells. Understanding the structure and function of HLA-A is essential for developing targeted immunotherapies and vaccines, as variations in HLA-A expression can influence individual immune responses and susceptibility to diseases. Furthermore, the study of HLA-A recombinants has significant implications for organ transplantation, as mismatches can lead to graft rejection. Advances in recombinant DNA technology enable researchers to produce HLA-A proteins in vitro, allowing for detailed analysis of their binding affinities, polymorphism, and interactions with T cell receptors. Such studies not only enhance our knowledge of T cell activation mechanisms but also aid in identifying potential biomarkers for diseases and improving personalized medicine approaches. The continued exploration of HLA-A recombinant proteins positions them as vital tools in advancing therapeutic strategies for autoimmune diseases, cancers, and transplantation medicine.
