Analytical Data
-
Gene name
cssB
- Application
-
Alternative Names
cssB；CS6 fimbrial subunit B
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53510
-
Expression Region
22-167aa
-
AA Sequence
GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN
-
Molecular Weight
31.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on cssB recombinant proteins has emerged from the need to better understand and harness the functionalities of proteins involved in various biological processes. cssB, a gene that encodes a protein with unique structural and functional properties, has attracted attention due to its potential applications in biotechnology, medicine, and environmental science. The emphasis on cssB proteins has intensified with advances in molecular biology techniques, allowing for the successful cloning, expression, and purification of recombinant versions of this protein. Researchers are particularly interested in cssB's role in cellular stress responses and its interaction with other biomolecules, which could reveal insights into fundamental processes such as protein folding, immune response, and pathogen resistance. Furthermore, investigating cssB recombinant proteins could lead to novel therapeutic strategies, including the development of vaccines or enzyme inhibitors. As studies continue to unfold, understanding the biophysical characteristics and functional implications of cssB proteins will not only broaden the scope of protein engineering but also contribute to the discovery of innovative solutions to pressing health and environmental challenges. The growing body of literature surrounding cssB underscores its significance in both basic research and applied sciences, highlighting the necessity for ongoing exploration in this promising area.
