Cat: PA2000-2712

Recombinant E.coli cssB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    cssB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    cssB;CS6 fimbrial subunit B

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P53510

  • Expression Region

    22-167aa

  • AA Sequence

    GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

  • Molecular Weight

    31.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on cssB recombinant proteins has emerged from the need to better understand and harness the functionalities of proteins involved in various biological processes. cssB, a gene that encodes a protein with unique structural and functional properties, has attracted attention due to its potential applications in biotechnology, medicine, and environmental science. The emphasis on cssB proteins has intensified with advances in molecular biology techniques, allowing for the successful cloning, expression, and purification of recombinant versions of this protein. Researchers are particularly interested in cssB's role in cellular stress responses and its interaction with other biomolecules, which could reveal insights into fundamental processes such as protein folding, immune response, and pathogen resistance. Furthermore, investigating cssB recombinant proteins could lead to novel therapeutic strategies, including the development of vaccines or enzyme inhibitors. As studies continue to unfold, understanding the biophysical characteristics and functional implications of cssB proteins will not only broaden the scope of protein engineering but also contribute to the discovery of innovative solutions to pressing health and environmental challenges. The growing body of literature surrounding cssB underscores its significance in both basic research and applied sciences, highlighting the necessity for ongoing exploration in this promising area.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US