Analytical Data
-
Gene name
rzoR
- Application
-
Alternative Names
rzoR；Prophage outer membrane lipoProtein RzoR
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58042
-
Expression Region
20-61aa
-
AA Sequence
CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW
-
Molecular Weight
19.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The repressor of the zinc-dependent operon, RzoR, is a critical protein involved in the regulation of gene expression in response to zinc availability in diverse bacteria. Research into RzoR has gained momentum as understanding its function could provide insights into bacterial adaptation and stress response mechanisms, particularly in fluctuating environmental conditions. Zinc is an essential micronutrient for most organisms, playing a vital role in various biochemical processes. In many bacteria, RzoR acts as a transcriptional regulator that binds to specific DNA sequences, modulating the expression of genes linked to zinc homeostasis and uptake when environmental zinc levels are low. The dysregulation of such systems can lead to growth deficiencies or toxic accumulations of metal ions. Consequently, the study of RzoR not only contributes to fundamental microbiology but also has potential implications for developing novel antibacterial strategies, as targeting zinc metabolism pathways can be an effective means of controlling bacterial growth. Advances in molecular biology techniques, such as protein crystallization and structural analysis, have facilitated the investigation of RzoR’s structure-function relationships, offering a detailed view of how this protein interacts with its target DNA. Moreover, elucidating the regulatory networks involving RzoR can pave the way for understanding the broader context of metal ion regulation in other pathogens and could inform the design of new antibiotics tailored to disrupt these pathways in clinically relevant bacteria. Overall, the exploration of RzoR and its associated regulatory mechanisms is of significant interest in both basic and applied microbiological research.
