Analytical Data
-
Gene name
CROT
- Application
-
Alternative Names
CROT；COT；Peroxisomal carnitine O-octanoyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKG9
-
Expression Region
1-87aa
-
AA Sequence
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
-
Molecular Weight
37.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CROT (Carnitine O-acetyltransferase) is a crucial enzyme involved in the metabolism of fatty acids, specifically in the transfer of acetyl groups between carnitine and acyl-CoA. This enzyme plays a significant role in the mitochondrial energy production process, linking fatty acid oxidation to the citric acid cycle. Given the rise in metabolic disorders, including obesity and type 2 diabetes, understanding CROT's function and regulation is increasingly important. Research into CROT recombinant protein has gained traction as it allows for the detailed study of its enzymatic properties, structural characteristics, and interactions with other metabolic pathways. By producing CROT in a recombinant form, scientists aim to elucidate its role in gluconeogenesis and lipid metabolism, potentially leading to novel therapeutic targets. Recent studies have explored CROT's expression patterns, regulatory mechanisms, and its implications in metabolic diseases, highlighting its potential as a biomarker or therapeutic target. Overall, the investigation of CROT recombinant protein represents a significant step toward unraveling the complexities of metabolic regulation and addressing health issues related to energy imbalance.
