Cat: PA2000-6483

Recombinant Human CCDC132 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCDC132

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VPS50; CCDC132; KIAA1861; Syndetin; Coiled-coil domain-containing Protein 132; EARP/GARPII complex subunit VPS50

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96JG6

  • Expression Region

    1-327aa

  • AA Sequence

    MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGKEEFRELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEAYRDKLKQQQAAVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTVCSDLITIHISLL

  • Molecular Weight

    63.7 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCDC132, or coiled-coil domain containing 132, is a protein that has garnered attention due to its potential role in various cellular processes, including cell division, differentiation, and signaling pathways. Research into CCDC132 has revealed its involvement in the structural integrity of the cytoskeleton and its interactions with other critical proteins, indicating a possible function in maintaining cellular architecture. Moreover, studies suggest that CCDC132 may play a role in the pathology of certain diseases, as alterations in its expression or function could disrupt normal cellular processes. Given its coiled-coil structure, CCDC132 is hypothesized to participate in protein-protein interactions, which are crucial for forming multi-protein complexes that regulate essential biological activities. Understanding the molecular mechanisms of CCDC132, including its expression patterns and functional implications, could provide insights into its contribution to health and disease. Thus, the recombinant production of CCDC132 protein is vital for advancing research into its biological roles and therapeutic potential, enabling detailed structural and functional studies that may open avenues for targeted treatments in diseases where CCDC132 is implicated. This growing body of research underscores the importance of CCDC132 as a target for further investigation in cellular biology and disease mechanisms, emphasizing its relevance in both basic and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US