Analytical Data
-
Gene name
CCDC132
- Application
-
Alternative Names
VPS50; CCDC132; KIAA1861; Syndetin; Coiled-coil domain-containing Protein 132; EARP/GARPII complex subunit VPS50
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96JG6
-
Expression Region
1-327aa
-
AA Sequence
MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGKEEFRELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEAYRDKLKQQQAAVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTVCSDLITIHISLL
-
Molecular Weight
63.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC132, or coiled-coil domain containing 132, is a protein that has garnered attention due to its potential role in various cellular processes, including cell division, differentiation, and signaling pathways. Research into CCDC132 has revealed its involvement in the structural integrity of the cytoskeleton and its interactions with other critical proteins, indicating a possible function in maintaining cellular architecture. Moreover, studies suggest that CCDC132 may play a role in the pathology of certain diseases, as alterations in its expression or function could disrupt normal cellular processes. Given its coiled-coil structure, CCDC132 is hypothesized to participate in protein-protein interactions, which are crucial for forming multi-protein complexes that regulate essential biological activities. Understanding the molecular mechanisms of CCDC132, including its expression patterns and functional implications, could provide insights into its contribution to health and disease. Thus, the recombinant production of CCDC132 protein is vital for advancing research into its biological roles and therapeutic potential, enabling detailed structural and functional studies that may open avenues for targeted treatments in diseases where CCDC132 is implicated. This growing body of research underscores the importance of CCDC132 as a target for further investigation in cellular biology and disease mechanisms, emphasizing its relevance in both basic and applied biomedical research.
