Analytical Data
-
Gene name
CCDC137
- Application
-
Alternative Names
CC137_HUMAN; CCDC137; Coiled coil domain containing 137; Coiled coil domain containing Protein 137; Coiled-coil domain-containing Protein 137; hepatocellular carcinoma related Protein 2; RaRF; Retinoic acid resistance factor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PK04
-
Expression Region
1-289aa
-
AA Sequence
MAGAGRGAAVSRVQAGPGSPRRARGRQQVQPLGKQRPAPWPGLRSKEKKKVNCKPKNQDEQEIPFRLREIMRSRQEMKNPISNKKRKKAAQVTFRKTLEKEAKGEEPDIAVPKFKQRKGESDGAYIHRMQQEAQHVLFLSKNQAIRQPEVQAAPKEKSEQKKAKKAFQKRRLDKVRRKKEEKAADRLEQELLRDTVKFGEVVLQPPELTARPQRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQL
-
Molecular Weight
59.6 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC137, also known as Coiled-Coil Domain Containing 137, is a gene that encodes a protein implicated in various cellular processes, including cell division and cellular signaling. Recent studies have highlighted its potential role in development and various diseases, particularly cancer. The coiled-coil domain suggests a structural role in mediating protein-protein interactions, which is crucial for the assembly of protein complexes involved in critical cellular mechanisms. Research indicates that alterations in the expression or function of CCDC137 may disrupt normal cellular functions and contribute to oncogenic processes. Understanding the structure and function of CCDC137 through recombinant protein techniques can provide valuable insights into its biological role and its potential as a therapeutic target. In particular, investigating CCDC137's interactions with other cellular proteins and its effects on cellular pathways may reveal novel strategies for cancer treatment. As the demand for effective cancer therapies continues to grow, the study of CCDC137's role in tumorigenesis and its associated signaling pathways stands as a promising area of research, potentially leading to new diagnostic or therapeutic approaches.
