Analytical Data
-
Gene name
pyrE
- Application
-
Alternative Names
pyrE；Orotate phosphoribosyltransferase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
C1D6F5
-
Expression Region
1-213aa
-
AA Sequence
MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR
-
Molecular Weight
38.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PyrE is a receptor protein found in specific microorganisms, notably within the systems involved in the degradation of pyrimidines, which are key components of nucleic acids. The study of PyrE has gained interest due to its potential applications in biotechnology and synthetic biology, particularly in the development of novel pathways for the biosynthesis of nucleotides and therapeutic compounds. Research has demonstrated that PyrE functions as a significant player in the metabolism of pyrimidine, acting as a sensor and regulator within metabolic networks. Insight into its structure and function could lead to advancements in enzyme engineering, enabling the creation of efficient biocatalysts for industrial applications. Furthermore, the characterization of PyrE's molecular interactions and its role in cellular metabolism can enhance our understanding of microbial ecosystems and their contributions to nutrient cycling. Ongoing studies are focused on elucidating the mechanisms by which PyrE operates and how it can be utilized for metabolic engineering purposes, potentially leading to innovative approaches in drug development and agricultural enhancement. As such, the recombinant expression of PyrE and its functional analysis are crucial for harnessing its properties and expanding its applications in various fields.
