Analytical Data
-
Gene name
S100A5
- Application
-
Alternative Names
S100A5;S100D;Protein S100-A5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33763
-
Expression Region
1-92aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMETPLEKALTTMVTTFHKYSGREGSKLTLS RKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLC MAYNDFFLEDNK
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
S100A5 is a member of the S100 family of proteins, characterized by their calcium-binding properties and involvement in various cellular processes. It plays a crucial role in regulating cell cycle progression, differentiation, and apoptosis, and its expression is associated with several pathological conditions, including cancers and inflammatory diseases. Recent studies have highlighted S100A5 as a potential biomarker and therapeutic target due to its upregulation in certain tumors, indicating its involvement in tumorigenesis and cancer progression. The interest in recombinant S100A5 protein stems from its potential applications in understanding its role in these diseases, elucidating the molecular mechanisms underlying its functions, and exploring its potential as a target for novel therapeutic interventions. Recombinant S100A5 allows for the study of its biochemical properties, interactions with other proteins, and its physiological roles in a controlled environment, which can lead to insights into its mechanisms of action. Furthermore, understanding S100A5's interactions at the molecular level may pave the way for the development of S100A5-based diagnostic and therapeutic strategies. As research continues, S100A5's dual role in normal physiology versus disease pathology is likely to provide significant insights into both basic cellular function and potential clinical applications.











