Analytical Data
-
Gene name
SLC12A6
- Application
-
Alternative Names
ACCPN; Electroneutral potassium-chloride cotransporter 3; Furosemide sensitive KCl cotransporter 3; Gaxp; K-Cl cotransporter 3; KCC 3; KCC 3A; KCC 3B; KCC3 A; KCC3; KCC3 B; KCC3A; KCC3B; Potassium chloride cotransporter 3; Potassium chloride cotransporter KCC3a S3; S12A6_HUMAN; SLC12 A6; SLC12A 6; SLC12A6; Solute carrier family 12 (potassium/chloride transporters); member 6; Solute carrier family 12 member 6; Solute carrier family 12; member 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHW9
-
Expression Region
1-90 aa
-
AA Sequence
MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD
-
Molecular Weight
35.64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC12A6 is a member of the solute carrier family and encodes a sodium-potassium-chloride co-transporter that plays a crucial role in ion homeostasis and cellular volume regulation. Recent studies have highlighted its significance in various physiological processes, including neuronal function and fluid balance. Mutations in SLC12A6 are associated with several neurological disorders, such as the early infantile epileptic encephalopathy (EIEE) characterized by seizures and cognitive impairment. Understanding the functional dynamics of SLC12A6 is critical, as it may provide insights into the underlying mechanisms of these diseases and identify potential therapeutic targets. Recombinant SLC12A6 protein is essential for studying the protein's structure, function, and interactions, allowing for the characterization of its transport activity and regulatory mechanisms in cellular models. This research facilitates the understanding of how SLC12A6 contributes to neuronal excitability and overall brain health, thereby advancing knowledge in both basic neuroscience and clinical applications. As a result, the production and study of recombinant SLC12A6 protein hold significant promise for unraveling the complexities of ion transport mechanisms and their implications in health and disease.
