Analytical Data
-
Gene name
CRK7
- Application
-
Alternative Names
arginine/serine-rich; Cdc2 related kinase arginine/serine rich; CDC2 related protein kinase 7; Cdc2-related kinase; CDC2-related protein kinase 7; Cdk12; CDK12_HUMAN; Cell division cycle 2 related protein kinase 7; Cell division cycle 2-related protein kinase 7; Cell division protein kinase 12; CRK7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYV4
-
Expression Region
1281-1380aa
-
AA Sequence
LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRK7, or cyclin-dependent kinase 7, is a crucial regulator in the cell cycle and transcriptional regulation, functioning as a component of the CDK-activating kinase (CAK) complex that phosphorylates and activates other cyclin-dependent kinases. Recent studies have highlighted its role beyond cell cycle regulation, including its involvement in transcriptional control of various genes, thereby influencing cellular response to stress and developmental processes. The interest in CRK7 has surged due to its connections to several diseases, including cancer, where dysregulation may lead to uncontrolled cell proliferation. Understanding CRK7's structure and function at the molecular level is essential for elucidating its precise role in these biological processes. Research on recombinant CRK7 proteins allows scientists to dissect its interactions with other cellular proteins and investigate potential inhibitory compounds that could serve as therapeutic agents. Moreover, studying CRK7 has implications for developing targeted therapies, especially in cancers that exhibit aberrant regulation of the cell cycle. Overall, the reconstituted CRK7 protein provides valuable insights into its mechanism of action and paves the way for future innovations in the treatment of related diseases.
