Cat: PA2000-6871

Recombinant Human CRKRS Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRKRS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    arginine/serine-rich; Cdc2 related kinase arginine/serine rich; CDC2 related protein kinase 7; Cdc2-related kinase; CDC2-related protein kinase 7; Cdk12; CDK12_HUMAN; Cell division cycle 2 related protein kinase 7; Cell division cycle 2-related protein kinase 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NYV4

  • Expression Region

    1281-1380aa

  • AA Sequence

    LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL

  • Molecular Weight

    36.63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRKRS, or Cysteine-Rich Protein Kinase Regulated by Stress, has garnered significant attention in recent years due to its critical role in cellular response to stress and its potential implications in various diseases, including cancer and neurodegenerative disorders. As a member of the protein kinase family, CRKRS is involved in various signaling pathways that regulate cellular activities such as proliferation, differentiation, and apoptosis. Research has shown that CRKRS expression levels can be influenced by various stressors, including oxidative stress, hypoxia, and nutrient deprivation, leading to its involvement in cellular adaptation mechanisms. Understanding the structure and functional mechanisms of CRKRS is vital for unraveling its role in stress response pathways and identifying potential therapeutic targets for diseases where these pathways are dysregulated. Recent advances in recombinant protein technology have enabled the production of CRKRS in a laboratory setting, facilitating detailed studies on its biochemical properties and interactions with other cellular components. By generating and characterizing CRKRS recombinant proteins, researchers aim to elucidate the protein's structure-function relationships and its regulatory mechanisms, paving the way for novel strategies in disease intervention and treatment. This research not only enhances our fundamental understanding of cellular responses to stress but also holds the promise of translating basic science into innovative therapeutic approaches for improving human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US