Analytical Data
-
Gene name
BAK1
- Application
-
Alternative Names
BAK1；BAK；BCL2L7；CDN1；Bcl-2 homologous antagonist/killer
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16611
-
Expression Region
1-211aa
-
AA Sequence
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAE GVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL QPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF LGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLL GQFVVRRFFKS
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BAK1 (BRI1-associated receptor kinase 1) is a key receptor-like kinase involved in plant immune responses and developmental processes. Its functions are mediated through its interaction with various signaling pathways, particularly in the context of plant defense against pathogens. Research has shown that BAK1 acts as a co-receptor for several plant pattern recognition receptors (PRRs), enhancing the perception of pathogen-associated molecular patterns (PAMPs) and orchestrating downstream immune responses. Given the critical role of BAK1 in plant immunity, the characterization of BAK1 recombinant proteins has become a focal point in molecular plant biology. Producing BAK1 as a recombinant protein allows researchers to study its biochemical properties, binding abilities, and interactions with other proteins in vitro. Moreover, understanding BAK1’s structure-function relationship can shed light on its precise role in signaling pathways, ultimately contributing to the development of crops with enhanced resistance to diseases. This research is vital in the context of global food security, as it can lead to innovative strategies for improving plant resilience against biotic stressors. Overall, the study of BAK1 recombinant proteins holds significant promise for advancing our knowledge of plant immunity and improving agricultural sustainability.
