Analytical Data
-
Gene name
SLC25A3
- Application
-
Alternative Names
Solute carrier family 25 member 3. Phosphate carrier protein. mitochondrial. Phosphate transport protein. PTP
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00325
-
Expression Region
1-361 aa
-
AA Sequence
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ
-
Molecular Weight
65.45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A3, a member of the solute carrier family, encodes a mitochondrial phosphate carrier that plays a critical role in cellular metabolism by facilitating the transport of inorganic phosphate into mitochondria. This process is essential for ATP synthesis, as phosphate is a key substrate needed for the phosphorylation of ADP to ATP. Dysfunctions in SLC25A3 have been linked to various metabolic disorders, including mitochondrial myopathy and other conditions characterized by impaired energy production. Given the significance of SLC25A3 in mitochondrial function, research into its recombinant protein has gained momentum. Studying the structural and functional properties of SLC25A3 can provide insights into its role in mitochondrial bioenergetics, the mechanisms underlying its transport activity, and the effects of mutations associated with disease. Furthermore, generating recombinant SLC25A3 allows for in-depth biochemical analyses and the development of novel therapeutic strategies targeting mitochondrial dysfunction. Investigations utilizing recombinant SLC25A3 are crucial for understanding the physiological mechanisms of phosphate transport in mitochondria and could pave the way for new interventions in mitochondrial diseases linked to SLC25A3 mutations.
