Analytical Data
-
Gene name
GATA4
- Application
-
Alternative Names
GATA4;Transcription factor GATA-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43694
-
Expression Region
343-442aa
-
AA Sequence
ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGH GPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GATA4 is a zinc-finger transcription factor that plays a critical role in cardiac and embryonic development, as well as in the regulation of various genes involved in cardiac hypertrophy and function. Its dysfunction has been implicated in a variety of cardiovascular diseases, including congenital heart defects and cardiomyopathies. Due to its significant biological importance, the study of GATA4 recombinant proteins has become a focal point for researchers investigating heart development and disease mechanisms. By producing and studying GATA4 recombinant proteins, scientists can explore its interactions with other proteins, its role in transcriptional regulation, and its potential as a therapeutic target. Fallouts from these studies could lead to advancements in understanding heart diseases, paving the way for new treatments. Additionally, the ability to manipulate this protein in a laboratory setting enhances our capacity to dissect the pathways regulated by GATA4 and provides insights into its function at a molecular level. Thus, GATA4 recombinant protein research holds promising potential for both fundamental science and clinical applications in cardiovascular medicine.











