Analytical Data
-
Gene name
DAZAP2
- Application
-
Alternative Names
DAZAP2; KIAA0058DAZ-associated protein 2; Deleted in azoospermia-associated protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15038
-
Expression Region
1-168aa
-
AA Sequence
MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
-
Molecular Weight
43.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAZAP2 (DAZ-associated protein 2) is a critical RNA-binding protein that plays a significant role in the post-transcriptional regulation of gene expression, particularly in germ cell development and testicular function. Research has increasingly focused on DAZAP2 due to its association with the Deleted in Azoospermia (DAZ) gene cluster, which is linked to male infertility and reproductive disorders. Studies suggest that DAZAP2 may be involved in the regulation of mRNA stability, splicing, and translation, impacting processes vital for spermatogenesis. Given its potential role as a biomarker for male infertility, understanding the molecular mechanisms underlying DAZAP2 function is paramount. Furthermore, the study of DAZAP2 and its interactions with other proteins could provide insights into the etiology of reproductive health issues, paving the way for novel therapeutic strategies. As researchers employ advanced techniques such as CRISPR-Cas9 and RNA sequencing, the characterization of DAZAP2, including its expression patterns and functional domains, is crucial for elucidating its contributions to fertility and reproductive success. This growing body of work highlights the importance of DAZAP2 in reproductive biology and its potential implications for diagnosing and treating infertility.
