Cat: PA2000-7003

Recombinant Human DAZAP2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DAZAP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DAZAP2; KIAA0058DAZ-associated protein 2; Deleted in azoospermia-associated protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15038

  • Expression Region

    1-168aa

  • AA Sequence

    MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW

  • Molecular Weight

    43.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DAZAP2 (DAZ-associated protein 2) is a critical RNA-binding protein that plays a significant role in the post-transcriptional regulation of gene expression, particularly in germ cell development and testicular function. Research has increasingly focused on DAZAP2 due to its association with the Deleted in Azoospermia (DAZ) gene cluster, which is linked to male infertility and reproductive disorders. Studies suggest that DAZAP2 may be involved in the regulation of mRNA stability, splicing, and translation, impacting processes vital for spermatogenesis. Given its potential role as a biomarker for male infertility, understanding the molecular mechanisms underlying DAZAP2 function is paramount. Furthermore, the study of DAZAP2 and its interactions with other proteins could provide insights into the etiology of reproductive health issues, paving the way for novel therapeutic strategies. As researchers employ advanced techniques such as CRISPR-Cas9 and RNA sequencing, the characterization of DAZAP2, including its expression patterns and functional domains, is crucial for elucidating its contributions to fertility and reproductive success. This growing body of work highlights the importance of DAZAP2 in reproductive biology and its potential implications for diagnosing and treating infertility.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US