Analytical Data
-
Gene name
STH
- Application
-
Alternative Names
STH；Saitohin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IWL8
-
Expression Region
1-128aa
-
AA Sequence
MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV
-
Molecular Weight
29.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of STH (serum thymic hormone) recombinant proteins is grounded in their potential to modulate immune response and influence cell differentiation and proliferation. STH, a peptide hormone originally derived from the thymus, plays a crucial role in T-cell maturation and the overall adaptive immune system. Given the therapeutic implications of enhancing immune function, particularly in immunocompromised patients and aging populations, researchers have focused on producing recombinant forms of STH to explore their efficacy and mechanisms of action. The ability to generate large quantities of STH through recombinant DNA technology allows for detailed studies on its structure-function relationships and interactions with immune cells. Additionally, understanding how STH can be utilized in combination with other treatments opens new avenues for developing immunotherapies for various diseases, including cancer and autoimmune disorders. The investigation of these recombinant proteins is essential not only for therapeutic applications but also for elucidating fundamental processes in immunology and cellular biology, making STH a significant focus in biomedical research.
