Analytical Data
-
Gene name
MBNL1
- Application
-
Alternative Names
MBNL1；EXP；KIAA0428；MBNL；Muscleblind-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR56
-
Expression Region
1-382aa
-
AA Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
-
Molecular Weight
53.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MBNL1 (Muscleblind-like splicing regulator 1) is a crucial protein involved in the regulation of pre-mRNA splicing and plays a significant role in cellular processes, particularly in muscle and nervous tissues. Research into MBNL1 has gained momentum due to its association with myotonic dystrophy, a genetic disorder characterized by progressive muscle wasting and myotonia, where aberrant splicing of target genes occurs. MBNL1 functions by recognizing specific RNA sequences and modulating the splicing patterns, thereby influencing gene expression. Abnormal levels of MBNL1 have been implicated in various pathophysiological conditions, making it a potential therapeutic target. The recombinant production of MBNL1 allows for in-depth studies of its biochemical properties, interactions with RNA substrates, and functional mechanisms in splicing regulation. This research is critical for advancing our understanding of RNA processing and its implications in diseases associated with dysfunctional splicing, potentially leading to the development of novel therapeutic strategies to mitigate the effects of splicing-related disorders. Furthermore, establishing a reliable method for producing recombinant MBNL1 facilitates high-throughput screening of small molecules that may restore normal splicing patterns, offering hope for targeted interventions in disorders such as myotonic dystrophy and beyond.
