Analytical Data
-
Gene name
CDC25B
- Application
-
Alternative Names
CDC25B;CDC25HU2;M-phase inducer phosphatase 2
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30305-2
-
Expression Region
375-551aa
-
AA Sequence
HRELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLKTRSWA
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
CDC25B is a pivotal protein belonging to the CDC25 phosphatase family, which plays a crucial role in the regulation of the cell cycle by dephosphorylating cyclin-dependent kinase (CDK) proteins, thereby activating them. Research on CDC25B has gained significant attention due to its involvement in cell cycle progression, particularly in the G2/M transition, where it helps ensure that cells only divide when they are ready. Dysregulation of CDC25B has been implicated in various cancers, as aberrant activation can lead to uncontrolled cell proliferation. This has fueled investigations into CDC25B as a potential therapeutic target and biomarker for cancer diagnosis and prognosis. Moreover, understanding the structure-function relationships of CDC25B through recombinant protein studies can provide insights into its regulatory mechanisms and interactions with other cellular components. Efforts to produce CDC25B as a recombinant protein have facilitated high-throughput screening for small molecules that can modulate its activity, leading to the development of novel anticancer strategies. These studies not only contribute to our understanding of cell cycle regulation but also pave the way for innovative therapeutic interventions targeting CDC25B in oncological contexts. Thus, CDC25B remains a focal point of research aimed at elucidating its fundamental role in cell cycle control and its implications in cancer biology.











