Analytical Data
-
Gene name
ARHGDIA
- Application
-
Alternative Names
ARHGDIA;GDIA1;Rho GDP-dissociation inhibitor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52565
-
Expression Region
1-204aa
-
AA Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRK YKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQ SFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG PRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKK DWKD
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARHGDIA, or Rho GDP dissociation inhibitor alpha, is a critical protein involved in the regulation of Rho GTPases, which are pivotal in various cellular processes, including cytoskeletal dynamics, cell migration, and signal transduction. The dysregulation of Rho GTPases has been implicated in several pathological conditions, such as cancer metastasis, cardiovascular diseases, and neurological disorders. Research into ARHGDIA has garnered significant attention due to its role in modulating RhoA activity and influencing cell morphology and motility. Understanding ARHGDIA's mechanisms and interactions can provide insights into cellular behavior and disease progression. Additionally, ARHGDIA's potential as a therapeutic target in cancer treatment is being explored, as manipulating its expression or function may alter tumor cell invasiveness. The study of recombinant ARHGDIA proteins allows for a detailed investigation of their biochemical properties and interactions with other proteins, facilitating the development of novel therapeutic strategies aimed at modulating the Rho signaling pathway. Overall, the investigation of ARHGDIA and its recombinant forms holds promise for advancing our understanding of cell biology and the underlying mechanisms of diseases associated with Rho GTPase dysregulation.











