Cat: PA1000-215DB

Recombinant Human ARHGDIA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARHGDIA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARHGDIA;GDIA1;Rho GDP-dissociation inhibitor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52565

  • Expression Region

    1-204aa

  • AA Sequence

    MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRK YKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQ SFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG PRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKK DWKD

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARHGDIA, or Rho GDP dissociation inhibitor alpha, is a critical protein involved in the regulation of Rho GTPases, which are pivotal in various cellular processes, including cytoskeletal dynamics, cell migration, and signal transduction. The dysregulation of Rho GTPases has been implicated in several pathological conditions, such as cancer metastasis, cardiovascular diseases, and neurological disorders. Research into ARHGDIA has garnered significant attention due to its role in modulating RhoA activity and influencing cell morphology and motility. Understanding ARHGDIA's mechanisms and interactions can provide insights into cellular behavior and disease progression. Additionally, ARHGDIA's potential as a therapeutic target in cancer treatment is being explored, as manipulating its expression or function may alter tumor cell invasiveness. The study of recombinant ARHGDIA proteins allows for a detailed investigation of their biochemical properties and interactions with other proteins, facilitating the development of novel therapeutic strategies aimed at modulating the Rho signaling pathway. Overall, the investigation of ARHGDIA and its recombinant forms holds promise for advancing our understanding of cell biology and the underlying mechanisms of diseases associated with Rho GTPase dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US