Analytical Data
-
Gene name
S100P
- Application
-
Alternative Names
S100 calcium binding protein P, S100E
-
Species
Human
-
Source
E. coli
-
Tag
N-6His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25815
-
Expression Region
1-95aa
-
AA Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKD KDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
S100P, a member of the S100 protein family, is a calcium-binding protein predominantly expressed in various tissues, including the nervous system, lungs, and gastrointestinal tract. Research into S100P has gained momentum due to its involvement in several pathophysiological processes, particularly cancer progression and metastasis. Elevated levels of S100P have been observed in various malignancies, serving as a potential biomarker for tumor diagnosis and prognosis. The protein is implicated in key cellular functions such as cell cycle regulation, differentiation, and apoptosis, and it influences signaling pathways associated with inflammation and oxidative stress. Furthermore, studies highlight its role in neurodegenerative diseases, making it a target of interest for therapeutic interventions. Given its dual functionality in promoting tumorigenesis and affecting neuronal health, the exploration of S100P's structure, interactions, and mechanisms of action continues to be a vital area of research that could lead to novel diagnostic and therapeutic strategies in oncology and neurology.
