Analytical Data
-
Gene name
IL-6
-
简介
IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. GMP IL-6 Protein, Human is the recombinant human-derived IL-6 protein, expressed by E. coli , with tag free. GMP IL-6 Protein, Human, has molecular weight of ~20.0 kDa.
- Application
-
Alternative Names
Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
P05231
-
Expression Region
V30-M212
-
AA Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-6 (IL-6) is a multifunctional cytokine that plays a critical role in immune response, inflammation, and hematopoiesis. It is produced by various cell types, including T cells, macrophages, and fibroblasts, and its dysregulation is associated with numerous pathological conditions, such as autoimmune diseases, cancers, and chronic inflammatory disorders. Research into IL-6 has gained prominence due to its dual role as both a pro-inflammatory and anti-inflammatory mediator, which complicates its therapeutic targeting. Recombinant IL-6 proteins are essential tools for studying its biological effects and mechanisms of action. These proteins can be produced using recombinant DNA technology, allowing for the generation of large quantities of biologically active IL-6 for research purposes. Investigations involving IL-6 recombinant proteins have provided insights into signaling pathways, interactions with IL-6 receptors, and the cytokine’s role in disease processes. Furthermore, IL-6 has emerged as a potential therapeutic target, prompting the development of IL-6 inhibitors for treating various diseases, including rheumatoid arthritis and COVID-19. Understanding the structure-function relationship of IL-6 through recombinant protein studies is crucial for the design of effective interventions, making the research into IL-6 recombinant proteins a significant area in cellular and molecular biology, as well as in clinical applications.











