Recombinant Human CD276/B7-H3 CD276/B7-H3 (4Ig)/B7-H3b Protein(HEK293), His

CD276/B7-H3 CD276/B7-H3 (4Ig)/B7-H3b

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, His) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

1.Immobilized Human B7-H3-His at 2μg/ml (100 μl/well) can bind Anti-Human B7-H3 mAb. The ED50 of Anti Human B7-H3 mAb is 16.7 ng/mL. 2.Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated Jurkat cells. T lymphocytes cultured for 72 hours were incubated for an additional 3 days in 96 well plates coated with 10 μg/mL anti-CD3 and 25 µg/mL B7-H3.The presence of B7-H3 at 25 µg/mL inhibited the anti-CD3 response is 30.58%.

CD276; B7H34Ig-B7-H3; B7-H3; B7 homolog 3; CD276 antigen; CD276 molecule; Costimulatory molecule

Human

HEK293

C-His

Greater than 90% as determined by SDS-PAGE.

Q5ZPR3-1

L29-T461

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT

Partial

65-90 kDa.

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.