Recombinant Others CD4 Protein(HEK293), His

CD4

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

T-cell surface glycoprotein CD4; T-cell surface antigen T4/Leu-3; CD4

Others

HEK293

C-His

Greater than 90% as determined by SDS-PAGE.

I6LI22

R26-L401

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Partial

52 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.