Analytical Data
-
Gene name
CD30/TNFRSF8
-
简介
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (HEK293, His) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human CD31L is immobilized at 2 µg/mL(100 µL/well) can bind Recombinant Human CD30. The ED50 for this effect is 51.71 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human CD31L is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Human CD30. The ED50 for this effect is 51.71 ng/mL.
-
Alternative Names
rHuTumor necrosis factor receptor superfamily member 8/CD30, His; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD30; TNFRSF8
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28908
-
Expression Region
F19-K379
-
AA Sequence
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
-
Protein Length
Partial
-
Molecular Weight
60-95 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD30, also known as TNFRSF8, is a member of the tumor necrosis factor receptor superfamily, playing a significant role in immune regulation, cell proliferation, and apoptosis. CD30 is primarily expressed on activated T cells, B cells, and certain hematological malignancies such as Hodgkin's lymphoma and anaplastic large cell lymphoma, making it a crucial target for therapeutic interventions. The recombinant CD30 protein has been extensively studied for its potential in immunotherapy, particularly in the development of monoclonal antibodies and chimeric antigen receptor (CAR) T-cell therapies. These therapeutic approaches aim to harness the body's immune system to specifically target and eliminate CD30-expressing tumor cells, thereby minimizing damage to normal tissues. The generation of recombinant CD30 proteins allows researchers to investigate its signaling pathways and biological functions, enhancing our understanding of its role in lymphoid malignancies. Furthermore, this protein serves as a valuable tool in preclinical studies to evaluate the efficacy of CD30-targeted therapies and to develop innovative treatment strategies for patients with CD30-positive cancers. As the field of immuno-oncology continues to evolve, the exploration of CD30/TNFRSF8 recombinant proteins represents a promising avenue for advancing targeted therapies and improving patient outcomes in hematological cancers.











