Analytical Data
-
Gene name
Haptoglobin
- Application
-
Alternative Names
Haptoglobin; Hp
-
Species
Mouse
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q61646
-
Expression Region
V19-N347
-
AA Sequence
VELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Haptoglobin is a vital plasma protein that plays a crucial role in hemoglobin metabolism and the body's response to hemolysis. It binds free hemoglobin released during red blood cell breakdown, facilitating its clearance and preventing oxidative damage. The study of recombinant haptoglobin has gained significance due to its potential applications in treating various conditions linked to hemolysis, such as sickle cell disease, thalassemia, and severe malaria. Additionally, haptoglobin levels can serve as biomarkers for several diseases, including cardiovascular disorders and inflammatory conditions. Advances in recombinant DNA technology have enabled the production of haptoglobin in larger quantities, improving our ability to investigate its therapeutic benefits and elucidate its specific biological functions. Researchers are particularly interested in its anti-inflammatory properties and its role in modulating immune responses, which could offer new avenues for treatment. The exploration of haptoglobin’s structure-function relationship, along with its interaction with other proteins, is essential for developing haptoglobin-based therapeutics. Moreover, understanding how genetic variations in haptoglobin affect disease susceptibility and progression can aid in personalized medicine approaches, making haptoglobin an important target in both clinical and pharmaceutical research.
