Analytical Data
-
Gene name
BSND
- Application
-
Alternative Names
BSND；BART；Barttin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WZ55
-
Expression Region
54-320aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSCQCYPKITFVPADSDFQGILSPKAMGL LENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRS LLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQS WPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQG CRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEA SDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on BSND (Bartter syndrome, neonatal type) recombinant protein stems from its crucial role in renal function and electrolyte homeostasis. BSND is a protein associated with Bartter syndrome, a genetic disorder characterized by renal salt wasting, hypokalemic metabolic alkalosis, and growth impairment in infants and children. The gene encoding BSND is vital for the proper functioning of the Na+-K+-2Cl- co-transporter in the thick ascending limb of the loop of Henle, which is essential for potassium and sodium reabsorption. Mutations in the BSND gene lead to dysfunctional renal tubular transport, resulting in the clinical manifestations of Bartter syndrome. Consequently, the study of BSND recombinant protein allows researchers to explore its structure, function, and interaction with other renal proteins, which can shed light on the pathophysiology of the disorder. Furthermore, understanding the mechanisms underlying BSND-related renal transport could pave the way for potential therapeutic strategies for managing Bartter syndrome and related electrolyte disorders, ultimately improving patient outcomes. This research also contributes to the broader field of renal physiology and may provide insights into other diseases pertaining to electrolyte imbalance, making BSND an important target for ongoing investigations.
