Analytical Data
-
Gene name
CA14
- Application
-
Alternative Names
CA14;C1orf67;Dynein axonemal heavy chain 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULX7
-
Expression Region
16-290aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSADGGQHWTYEGPHGQDHWPASYPECGN NAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPS TLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSD SYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTS VPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLE KLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CA14, also known as carbonic anhydrase XIV, is an enzyme that plays a critical role in maintaining acid-base balance in various tissues. It catalyzes the reversible conversion of carbon dioxide and water to bicarbonate and protons, a reaction crucial for physiological processes, including respiration, renal function, and electrolyte transport. Research into CA14 has been motivated by its involvement in several pathological conditions, such as neurodegenerative diseases and certain cancers, where its expression levels may be altered. The interest in CA14 is further amplified by its tissue-specific expression, particularly in the brain, suggesting that it may have unique roles in neurotransmission and neuroprotection. Moreover, understanding the structure-function relationship of CA14 can lead to new therapeutic targets, as inhibitors of carbonic anhydrases have been explored as potential treatments for a variety of conditions. Recent studies have focused on characterizing the recombinant form of CA14 to elucidate its enzymatic properties, substrate specificity, and potential interactions with other biomolecules. This foundational knowledge is crucial not only for basic biochemical understanding but also for the development of CA14 as a biomarker or therapeutic target in clinical applications. The continued investigation of CA14 is vital for advancing our comprehension of its biological significance and potential implications in health and disease.











