Cat: PA1000-391DB

Recombinant Human CA14 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CA14

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CA14;C1orf67;Dynein axonemal heavy chain 14

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9ULX7

  • Expression Region

    16-290aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSADGGQHWTYEGPHGQDHWPASYPECGN NAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPS TLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSD SYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTS VPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLE KLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CA14, also known as carbonic anhydrase XIV, is an enzyme that plays a critical role in maintaining acid-base balance in various tissues. It catalyzes the reversible conversion of carbon dioxide and water to bicarbonate and protons, a reaction crucial for physiological processes, including respiration, renal function, and electrolyte transport. Research into CA14 has been motivated by its involvement in several pathological conditions, such as neurodegenerative diseases and certain cancers, where its expression levels may be altered. The interest in CA14 is further amplified by its tissue-specific expression, particularly in the brain, suggesting that it may have unique roles in neurotransmission and neuroprotection. Moreover, understanding the structure-function relationship of CA14 can lead to new therapeutic targets, as inhibitors of carbonic anhydrases have been explored as potential treatments for a variety of conditions. Recent studies have focused on characterizing the recombinant form of CA14 to elucidate its enzymatic properties, substrate specificity, and potential interactions with other biomolecules. This foundational knowledge is crucial not only for basic biochemical understanding but also for the development of CA14 as a biomarker or therapeutic target in clinical applications. The continued investigation of CA14 is vital for advancing our comprehension of its biological significance and potential implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US