Analytical Data
-
Gene name
CLEC4E
- Application
-
Alternative Names
CLEC4E；CLECSF9；MINCLE；C-type lectin domain family 4 member E
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULY5
-
Expression Region
41-219aa
-
AA Sequence
RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSS CYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQ NWNDVTCFLNYFRICEMVGINPLNKGKSLVDHHHHHH
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLEC4E, also known as DC-SIGNR (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Nonintegrin), is a C-type lectin receptor predominantly expressed in dendritic cells and macrophages. It plays a crucial role in the immune system by recognizing and binding to various pathogens, including viruses, bacteria, and parasites, which facilitates their uptake and presentation to T cells. This mechanism is vital for initiating adaptive immune responses. Recent studies have highlighted the importance of CLEC4E in mediating infections, notably with viruses like HIV and Ebola, as it can serve as a viral entry receptor. Moreover, CLEC4E's role in modulating immune responses has garnered attention for its potential implications in autoimmune diseases and cancer immunotherapy. Understanding the structure and function of CLEC4E can lead to novel therapeutic strategies, including vaccine development and targeted treatments. Researchers are now focusing on elucidating the molecular mechanisms underlying its interactions with pathogens and exploring its potential as a biomarker for various diseases. This research is critical for advancing our knowledge of immune defense mechanisms and developing innovative approaches to combat infectious diseases and promote better health outcomes.
