Analytical Data
-
Gene name
LPAR3
- Application
-
Alternative Names
LPAR3；EDG7；LPA3；Lysophosphatidic acid receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBY5
-
Expression Region
298-353aa
-
AA Sequence
EDMYGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
-
Molecular Weight
11.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LPAR3, or lysophosphatidic acid receptor 3, is a G protein-coupled receptor involved in various physiological processes, including cell proliferation, migration, and survival. Its role has gained significant attention in recent years due to its association with multiple diseases, particularly in the context of cancer and fibrosis. Dysregulation of LPAR3 signaling pathways has been implicated in tumor progression and metastasis, making it a potential therapeutic target. Additionally, LPAR3 is involved in mediating the effects of lysophosphatidic acid (LPA), a bioactive lipid that influences cellular responses in the immune system and nervous system. The study of LPAR3 recombinant proteins is crucial for understanding the receptor's structure-function relationships and its signaling mechanisms. By producing LPAR3 in a recombinant system, researchers can investigate its binding properties, downstream signaling pathways, and interactions with ligands. This research is vital for the development of targeted therapies aimed at modulating LPAR3 activity, which could lead to novel treatments for diseases linked to LPAR3 dysregulation. Furthermore, understanding LPAR3 at a molecular level can provide insights into its role in normal physiology and pathophysiology, potentially revealing new biomarkers for disease diagnosis and prognosis. Thus, the investigation of LPAR3 recombinant proteins not only enhances our understanding of this receptor but also opens avenues for innovative therapeutic strategies.
