Cat: PA1000-863DB

Recombinant Human DERA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DERA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DERA;Deoxyribose-phosphate aldolase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y315

  • Expression Region

    1-318aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSAHNRGTELDLSWISKIQVNHPAVLRRAE QIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIR EDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFP AGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRK ACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATF PVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEW LKPELFRIGASTLLSDIERQIYHHVTGRYAAYHDLPMS

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DERA (deoxyribose-phosphate aldolase) is an enzyme that plays a crucial role in the salvage pathway of nucleotide synthesis, specifically in the conversion of ribose and deoxyribose sugars into nucleotide precursors. The research surrounding DERA recombinant proteins has gained significant attention due to their potential applications in biotechnology and medicine. Understanding the structure and function of DERA is essential for developing novel strategies to manipulate nucleotide metabolism in various organisms. Moreover, recombinant DERA proteins can be engineered for enhanced stability and activity, which can facilitate the production of nucleoside analogs important for antiviral and anticancer therapies. Studies have shown that recombinant DERA can be efficiently expressed in heterologous systems, allowing researchers to produce large quantities of the enzyme for biochemical assays and industrial applications. Additionally, structural studies have provided insights into the enzyme's catalytic mechanisms, further informing potential modifications for improved activity. As such, the ongoing research into DERA recombinant proteins represents a promising frontier in the fields of metabolic engineering, drug development, and synthetic biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US