Analytical Data
-
Gene name
MYOG
- Application
-
Alternative Names
MYOG;BHLHC3;MYF4;Myogenin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15173
-
Expression Region
1-224aa
-
AA Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPL EDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEA FEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRG GGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHS LTSIVDSITVEDVSVAFPDETMPN
-
Molecular Weight
51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYOG, or Myogenin, is a key transcription factor critically involved in the regulation of muscle development and differentiation. Research on MYOG has gained significant attention due to its essential role in myogenesis, the process by which muscle cells form and mature. Understanding MYOG's molecular mechanisms provides insights into muscle-related diseases, such as muscular dystrophies and age-related muscle degeneration. The study of recombinant MYOG proteins is particularly important as it allows for the investigation of their functional properties and interactions within the muscle cellular environment. By producing MYOG in a recombinant form, researchers can manipulate its expression, study its binding affinities to DNA, and explore its effects on downstream target genes essential for muscle development. Additionally, recombinant MYOG can serve as a valuable tool for developing biotherapies aimed at muscle regeneration and repair. As the demand for effective treatments for muscle-wasting conditions grows, research involving MYOG is poised to contribute significantly to therapeutic advancements, highlighting its potential role in regenerative medicine and muscle biology.











