Analytical Data
-
Gene name
MTF1
- Application
-
Alternative Names
MTF1；Metal regulatory transcription factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01538
-
Expression Region
900-1101aa
-
AA Sequence
GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ
-
Molecular Weight
26.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTF1 (Metal regulatory transcription factor 1) is a crucial protein that plays a significant role in cellular metal homeostasis and detoxification, particularly in response to heavy metals such as cadmium and zinc. The regulation of MTF1 is essential for maintaining cellular health, as dysregulation can lead to various diseases, including neurodegenerative disorders and cancers. Research into MTF1 has gained momentum due to its central role in metal ion sensing and regulatory pathways, including the expression of genes involved in antioxidant defenses and metal transport. Studies have shown that MTF1 functions as a transcription factor that activates the expression of metallothioneins and other cytoprotective proteins, which help mitigate metal-induced stress. Furthermore, understanding the mechanisms of MTF1 activation and its downstream effects can provide insights into potential therapeutic targets for diseases associated with metal toxicity. Advances in recombinant protein expression technologies have allowed for the production of MTF1 in sufficient quantities, enabling detailed biochemical and structural studies. This research is significant, not only for elucidating the fundamental biological processes governed by MTF1 but also for exploring its implications in environmental health, toxicology, and pharmacology. Overall, MTF1 serves as an important model for investigating the interplay between metal ions and cellular signaling, highlighting its potential in developing strategies to counteract the adverse effects of metal exposure.
