Analytical Data
-
Gene name
MT2
- Application
-
Alternative Names
MT2；CES1；MT2；Metallothionein-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02795
-
Expression Region
1-59aa
-
AA Sequence
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
-
Molecular Weight
7.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT2 (metallothionein 2) is a low-molecular-weight, cysteine-rich protein that plays a crucial role in metal ion homeostasis, detoxification, and cellular defense mechanisms. It is part of a larger family of metallothioneins, which are known for their ability to bind heavy metals such as zinc, copper, and cadmium, thereby protecting cells from metal toxicity and oxidative stress. Research on MT2 has gained significant attention due to its involvement in various physiological processes and its potential implications in health and disease. Studies indicate that MT2 is not only vital for maintaining metal balance in cells but also influences critical pathways such as cell proliferation, apoptosis, and immune response. Alterations in MT2 expression have been associated with several pathological conditions, including cancer, neurodegenerative diseases, and inflammatory disorders, making it an important biomarker for disease diagnosis and prognosis. Moreover, the modulation of MT2 expression presents potential therapeutic avenues, as enhancing its function could protect against metal-induced damage and promote cellular resilience. Understanding the molecular mechanisms governing MT2's role in these processes is essential for developing targeted interventions and advancing our knowledge of cellular defense systems. As research continues, MT2 and its recombinant forms are being explored for therapeutic applications, including in the fields of biomedicine and biotechnology, highlighting its significance in both fundamental and applied sciences.
