Analytical Data
-
Gene name
FKBP1B
- Application
-
Alternative Names
FKBP1B;FKBP12.6;FKBP1L;Peptidyl-prolyl cis-trans isomerase FKBP1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68106
-
Expression Region
1-108aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHRSMGVEIETISPGDGRTFPKKGQTCVVHYT GMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCT PDVAYGATGHPGVIPPNATLIFDVELLNLE
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FKBP1B, or FK506-binding protein 1B, is a member of the FKBP family of immunophilins that serves as a peptidyl-prolyl cis-trans isomerase, facilitating protein folding and regulation within cells. This protein has garnered significant interest due to its role in critical biological processes such as immune response, cell signaling, and apoptosis. Research has highlighted its involvement in various diseases, including cancer and neurodegenerative disorders, indicating that FKBP1B may hold therapeutic potential. The recombinant production of FKBP1B enables detailed studies into its structure-function relationship, post-translational modifications, and interactions with other proteins. Utilizing advanced techniques in molecular cloning and expression systems, scientists aim to generate high yields of functional FKBP1B for use in biochemical assays and structural biology. Furthermore, understanding FKBP1B's mechanism of action may open new avenues for drug design, targeting its interaction pathways. As a result, FKBP1B recombinant protein research is pivotal for elucidating its biological significance and potential applications in medicine.











