Analytical Data
-
Gene name
FKBP1A
- Application
-
Alternative Names
FKBP1A；FKBP1；FKBP12;Peptidyl-prolyl cis-trans isomerase FKBP1A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62942
-
Expression Region
2-103aa
-
AA Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
-
Molecular Weight
38.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FKBP1A, or FK506 binding protein 1A, is a pivotal member of the FK506-binding protein family, known for its role as a peptidyl-prolyl cis-trans isomerase. This protein is crucial in modulating protein folding and regulating various cellular processes, including signal transduction, immune response, and apoptosis. Research into recombinant FKBP1A has gained momentum due to its implications in diverse biological functions and disease mechanisms. Notably, FKBP1A is involved in the immunosuppressive action of the drug FK506 (tacrolimus), commonly used in organ transplantation to prevent rejection. By studying FKBP1A in its recombinant form, scientists aim to elucidate its structural and functional properties, investigate its interactions with other proteins, and identify potential therapeutic targets. The use of recombinant technology allows for the production of FKBP1A in a controlled environment, facilitating high-purity samples for biochemical and pharmacological studies. Furthermore, FKBP1A's involvement in numerous diseases, including cancer and neurodegenerative disorders, has prompted extensive effort to explore its role as a biomarker or therapeutic target. Overall, FKBP1A recombinant protein research not only enhances our understanding of fundamental biological processes but also opens avenues for novel therapeutic strategies in various diseases. Through the concerted efforts of researchers, insights gained from FKBP1A studies may lead to innovative approaches in drug development and personalized medicine.
