Analytical Data
-
Gene name
MYLK
- Application
-
Alternative Names
MYLK；MLCK；MLCK1；MYLK1；Myosin light chain kinase. smooth muscle
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15746
-
Expression Region
1464-1719aa
-
AA Sequence
YDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWL
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYLK, or Myosin Light Chain Kinase, is a critical enzyme involved in various cellular processes, particularly in muscle contraction and regulation of the cytoskeleton. The interest in MYLK has surged due to its pivotal role in smooth muscle function and cardiac physiology. Dysregulation of MYLK activity has been implicated in various pathological conditions, including hypertension, asthma, and cardiac dysfunction, making it a potential therapeutic target. Recent research has focused on the molecular mechanisms governing MYLK's activity, including its regulation by calcium and calmodulin, as well as its involvement in signaling pathways that affect cell migration and proliferation. Reconstituting MYLK in experimental models can elucidate its functional dynamics and provide insights into how its activity can be modulated in disease states. Advances in recombinant protein technology have enabled scientists to produce and study MYLK in vitro, allowing for a better understanding of its structure-function relationship and interactions with other proteins. This research aims to pave the way for developing novel interventions that target MYLK-related pathways, potentially leading to innovative treatments for diseases linked to smooth muscle and cardiac dysfunction. Overall, the investigation of MYLK as a recombinant protein holds significant promise in both basic biology and clinical application, addressing vital questions regarding its role in health and disease.
